PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G304100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 350aa    MW: 38984.8 Da    PI: 9.7308
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G304100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding636.1e-201762147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
  Aqcoe6G304100.1.p 17 KGPWSPEEDDLLTKLVERHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 62
                       79******************************.***********985 PP

2Myb_DNA-binding53.94.2e-1771113347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++++eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Aqcoe6G304100.1.p  71 AFSAEEDETIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 113
                        79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.6951267IPR017930Myb domain
SuperFamilySSF466893.15E-3114110IPR009057Homeodomain-like
SMARTSM007171.0E-171665IPR001005SANT/Myb domain
PfamPF002491.4E-191762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-261870IPR009057Homeodomain-like
CDDcd001672.88E-161961No hitNo description
SMARTSM007171.2E-1468116IPR001005SANT/Myb domain
PROSITE profilePS5129421.03269118IPR017930Myb domain
PfamPF002492.8E-1471113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2371117IPR009057Homeodomain-like
CDDcd001671.30E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MAATSSTTSR RDLDRIKGPW SPEEDDLLTK LVERHGPRNW SLISKSIPGR SGKSCRLRWC  60
NQLSPQVEHR AFSAEEDETI IRAHAKFGNK WATIARLLSG RTDNAIKNHW NSTLKRKCSF  120
STSTSSTTTS MMMMMNNEDD DNNNNLDRDL NRPFKRRSSS VGTVIPMMSS SSGSDLSDSS  180
LPSPVIYRPV ARTGVVLPLN RETSSSTNNI DPPTSLCLSL PGTTTTVTTT TDSFEDHSKP  240
SSDKQQQPMQ QFSPPPPTPT PLSSAVSSHQ HHQQQKQKQQ LSYINKAFSP EFLSVMQEMI  300
KKEVRNYMSG LEQQQQQMMM MNSNGGHCLQ AIDGIRNAVV NRIGINKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-391611857159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-391611857159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268121.11e-114sucrose responsive element binding protein
SwissprotQ9FDW13e-78MYB44_ARATH; Transcription factor MYB44
TrEMBLE3WDH41e-117E3WDH4_COPJA; Transcriptional factor MYB-1
STRINGVIT_07s0129g01050.t011e-115(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-72myb domain protein 73